PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G038600.1.p
Common NameGLYMA_01G0386002, Glyma01g04530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 301aa    MW: 32222.1 Da    PI: 10.1966
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G038600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-1490134347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Glyma.01G038600.1.p  90 PWTEEEHRLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKY 134
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.631520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.55483139IPR017930Myb domain
SuperFamilySSF466897.9E-1785138IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-1686137IPR006447Myb domain, plants
SMARTSM007171.2E-1087137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-1189134IPR009057Homeodomain-like
CDDcd001679.52E-1090135No hitNo description
PfamPF002492.2E-1190134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSRTCSQCGN NGHNSRTCTD GGAAGSPREN GIMLFGVRVM TEANSSFRKS ASMNNLSQYD  60
AEFNAADAGY ASDDVVHASG RTRERKRGVP WTEEEHRLFL LGLHKVGKGD WRGISRNFVK  120
TRTPTQVASH AQKYFLRRHN QNRRRRRSSL FDITTDTVME SSTIMEEEQV PPETVAAPLP  180
AAYPPSHYGA FAGAGFPIAP VVLPVSGERL TKPIRPTPIL PVPPSSKMAN LNLKEKASPT  240
NLIEPLPLSL NLPSPTPRSQ DQSSASSGHS SPSSSSSAAA FQAMSAAKFG SGGDSIISVA  300
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.289960.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312470.0KT031247.1 Glycine max clone HN_CCL_86 MYB/HD-like transcription factor (Glyma01g04530.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237761.11e-171MYB transcription factor MYB138
RefseqNP_001304346.11e-171transcription factor MYB1R1
RefseqXP_003517881.21e-171PREDICTED: transcription factor MYB1R1
TrEMBLI1J5G90.0I1J5G9_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA01G04530.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-77MYB_related family protein
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]